PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03203A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MIKC_MADS
Protein Properties Length: 307aa    MW: 34591.1 Da    PI: 9.8016
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03203AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.8e-3163113151
                                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifss+g+lyeys+
  Oropetium_20150105_03203A  63 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSSRGRLYEYSN 113
                                79***********************************************95 PP

2K-box89.46.9e-301332285100
                      K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                                s   ++e + ++++qe+akLk++i +Lq+++R l G+++ ++s ++L++Le +L+k+l kiR++Knell++++e++ ++e elq
  Oropetium_20150105_03203A 133 SAGTTAEITIQHYKQESAKLKQQITTLQNSNRTLTGDGIATMSQRDLKHLEGRLDKGLAKIRARKNELLYSEVEYMERREMELQ 216
                                4444788899************************************************************************** PP

                      K-box  89 eenkaLrkklee 100
                                ++n +L++++ee
  Oropetium_20150105_03203A 217 NDNLYLKSRVEE 228
                                *******99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.2E-3755114IPR002100Transcription factor, MADS-box
CDDcd002656.72E-4155132No hitNo description
PRINTSPR004042.3E-305777IPR002100Transcription factor, MADS-box
PROSITE patternPS00350057111IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-3158131IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.48759115IPR002100Transcription factor, MADS-box
PfamPF003194.6E-2664111IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-307792IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-3092113IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.589142232IPR002487Transcription factor, K-box
PfamPF014861.5E-22142226IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MHIQEIQQPV PSTDDFMSTL TSVGLKLKDP MPSPGSASAA GPASAAAAAE KATGGKGKKV  60
EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDAEIALI IFSSRGRLYE YSNSSVRAAI  120
ERYKKVTSSD SSSAGTTAEI TIQHYKQESA KLKQQITTLQ NSNRTLTGDG IATMSQRDLK  180
HLEGRLDKGL AKIRARKNEL LYSEVEYMER REMELQNDNL YLKSRVEENE RAKQTANMMG  240
APSTSEYQQQ SFLPYDPIRS FLQFNIMQQQ QQTPPPQPPQ YYSQQQRQEE DDRKVLNLGK  300
ILRHLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-1958136482Myocyte-specific enhancer factor 2B
1tqe_Q2e-1958136482Myocyte-specific enhancer factor 2B
1tqe_R2e-1958136482Myocyte-specific enhancer factor 2B
1tqe_S2e-1958136482Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105321.11e-145homologue of Arabidopsis gene AGAMOUS
SwissprotQ2V0P11e-119MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-145Q41876_MAIZE; Uncharacterized protein
STRINGGRMZM2G052890_P011e-144(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-83MIKC_MADS family protein